فهرست پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار
فهرست:
چکیده......................................................................................................................................................................1
فصل اول: مقدمه
مقدمه.......................................................................................................................................................................4
1-2- اهداف طرح.................................................................................................................................................6
1-3- فرضیههای طرح.........................................................................................................................................6
فصل دوم: بررسی منابع
2- 1- مقدار مواد مغذی مورد نیاز گوسالههای جوان.................................................................................8
2-2- انرژی مورد نیاز گوسالهها.........................................................................................................................9
2-2-1- متابولیسم در حالت ناشتا (میزان متابولیسم پایه)........................................................................9
2-2-2- انرژی قابل متابولیسم.......................................................................................................................10
2-3- پروتئین مورد نیاز گوسالهها.................................................................................................................12
2-3-1- پروتئین مورد نیاز برای نگهداری ..................................................................................................12
2-3- 2- اثرات شرایط محیطی بر روی انرژی و پروتئین مورد نیاز گوساله.... ....................................16
2-4- سایر جنبههای تغذیه گوساله .............................................................................................................17
2-4- 1- تغذیه جنین .....................................................................................................................................17
2-4- 2- آغوز.....................................................................................................................................................18
2-4- 3- آب و الکترولیتها ...........................................................................................................................19
2-4- 4- مواد جایگزین شیر ..........................................................................................................................20
2-4- 5- مواد افزودنی ....................................................................................................................................22
2-4- 6- توجهات عملی خوراک دادن ........................................................................................................23
2-5- شیر و عملکرد گوساله............................................................................................................................25
2-5-1- شیر و ماده خشک موجود درآن.....................................................................................................25
2-5-2- شیر و خوراک مصرفی......................................................................................................................26
2-5-3- دوره پیش از شیرگیری....................................................................................................................31
2-5-4- دوره پس از شیرگیری......................................................................................................................33
2-5-5- اثرات طولانی مدت............................................................................................................................34
256 توسعه شکمبه.....................................................................................................................................35
2-6- معرفی گیاهان دارویی و تاثیر آن بر عملکرد حیوانات....................................................................37
2-6-1- تاثیر رزماری بر عملکرد حیوانات....................................................................................................40
2-6-2- تاثیر مرزه بر عملکرد حیوانات.........................................................................................................41
2-6-3- تاثیر زنجبیل بر عملکرد حیوانات...................................................................................................42
2-6-4- اشکال متداول استفاده از گیاهان دارویی در دامپروری.............................................................44
2-6-4-1- پودر.................................................................................................................................................44
2-6-4-2- چایها.............................................................................................................................................45
2-6-4-3- جوشاندهها......................................................................................................................................45
2-6-4-4- خیسانده گیاه.................................................................................................................................45
2-6-4-5- عصارهها...........................................................................................................................................46
2-6-4-6- اسانسها..........................................................................................................................................47
2-6-4-7- کپسولها و قرصها......................................................................................................................47
2-6-4-8- ضمادها............................................................................................................................................47
2-6-4-9- کمپرسها.......................................................................................................................................47
2-6-4-10- شربت............................................................................................................................................48
2-6=4- 11- لوسیون.......................................................................................................................................48
2-6-4- 12- پماد و کرمها.............................................................................................................................48
2-6-4-13- اسپری، بخور...............................................................................................................................48
2-6-4-14- دود دادن.....................................................................................................................................48
فصل سوم: مواد و روش کار
3-1- مکان و زمان اجرای طرح......................................................................................................................50
3-2- نحوه اجرای طرح ...................................................................................................................................50
3-3- مدیریت گوسالهها ..................................................................................................................................51
3-4- اندازه گیری ها و نمونه برداری ها.......................................................................................................52
3-4-1- خوراک مصرفی..................................................................................................................................52
3-4-2- وزن بدن..............................................................................................................................................53
3-4-3- امتیاز مدفوع.......................................................................................................................................53
3-4-4- رشد اسکلتی.......................................................................................................................................53
3-4-5- نمونهگیری از خون. 53
3-5- تجزیه و تحلیل آماری. 54
فصل چهارم: بحث و نتایج
4- مصرف جیره آغازین, ماده خشک مصرفی، افزایش وزن روزانه, بازده خوراک ,وزن از شیرگیری و وزن نهایی............................................................................................................................................................58
41- جیره آغازین مصرفی...............................................................................................................................58
42- ماده خشک مصرفی.................................................................................................................................61
43- بازده خوراک.............................................................................................................................................63
44- افزایش وزن روزانه...................................................................................................................................67
4-5- وزن از شیرگیری و وزن نهایی..............................................................................................................69
46- امتیاز مدفوع..............................................................................................................................................70
47- صفات مربوط به رشد اسکلتی..............................................................................................................71
4-7-1- دور سینه..............................................................................................................................................71
4-7-2- عرض بین استخوان هیپ.................................................................................................................72
48- فراسنجههای سرم خون در دورههای 9، 30، 40 و 70 روزگی....................................................72
48-1- بتا- هیدروکسی بوتیرات...................................................................................................................76
48-2- گلوکز.....................................................................................................................................................76
48-3- آلبومین.................................................................................................................................................79
48-4- پروتئین کل.........................................................................................................................................81
48-5- گلوبولین...............................................................................................................................................82
فصل پنجم: نتیجه گیری
5 نتیجه گیری...................................................................................................................................................85
51 مشکلات و محدودیتهای این پژوهش...............................................................................................85
52 پیشنهادات.................................................................................................................................................85
منابع.................
منبع:
man, M. M. and R.L.Kincaid. 1995. Effect of selenium supple mentation of cows on maternal transfer of selenium to fetal and new born calves. J.DairySci 78:625– 630.
[2] Abdollahiacdefg, M., A. Salehniaag, S. H. R. Mortazavib, M. Ebrahimi, A. Shafiee, F. Fouladian, K. Keshavarz, S. Sorouri, R. Khorasani, and A. Kazemi. 2003. Antioxidant, antidiabetic, antihyperlipidemic, reproduction stimulatory properties and safety of essential oil of Satureja Khuzestanica in rat in vivo:a toxicopharmacological study. Med Sci Monit 9:331-335.
[3] Abe, F., N.Ishibashi and Shimamura. 1995. Effect of administration of bifidobacteriaand lactic acid bacteria to new born calves and piglets J. DairySci 78:2838– 2846.
[4] Amagase, H., B. L. Petesch, H. Matsuura, S. Kasuga, and Y. Itakura. 2001. Intake of garlic and its bioactive components. Journal of Nutrition 131 955S-962S.
[5] Anderson, K. L., T.G.Nagaraja, and J.L.Morrill. 1987a. Ruminal metabolic develop mentin calves weaned conventionallyorearly. J. DairySci 70:1000– 1005.
[6] Anderson, K. L., T.G.Nagaraja, J.L.Morrill, T.B.Avery, S.J.Galitzer, and J.E.Boyer. 1987b. Ruminalmicrobialdevelopmentinconventionally orearly weaned calves. J.Anim.Sci 64:1215- 1226.
[7] Appleby, M. C., D. M. Weary, and B. Chua. 2001. Performance and feeding behavior of calves on ad libitum milk from artificial teats. Appl. Anim. Behav. Sci. 74:191–201.
[8] Arash Khaki, D., F. Fathiazad, M. Nouri, A. Afshin, and D. Hamadeh. 2009. The effects of Ginger on spermatogenesis and sperm parameters of rat. Iranian Journal of Reproductive Medicine 7(1):7-12.
[9] Arieli, A., J. W. Schrama, and W. Van Der Hel. 1995. Develo energy in young calves. J. Dairy Sci 78:1154–1162.
[10] Arthington, J. D., M.B.Cattell, and I. J.D.Quigley. 2000. Effectof dietary IgG source (colostrum,serum,ormilk-derivedsupplement) on the efficiency of Ig absorptionin new born Holstein calves. J.Dairy Sci 83:1463– 1467.
[11] BakIrel, T., U. BakIrel, O. Ü. Keles, S. G. Ülgen, and H. Yardibi. 2008. In vivo assessment of antidiabetic and antioxidant activities of rosemary (Rosmarinus officinalis) in alloxan-diabetic rabbits. Journal of Ethnopharmacology 116(1):64-73.
[12] Baldwin, R. L. V., K. R. McLeod, J. L. Klotz, and R. N. Heitmann. 2004. Rumen development, intestinal growth and hepatic metabolism
in the pre- and postweaning ruminant. J. Dairy Sci 87:(E.Suppl.):E55–E65.
[13] Ballou, M. A., C. J. Cobb, T. J. Earleywine, and B. S. Obeidat. 2013. Interaction of breed and plane of milk replacer nutrition on the performance of pre- and postweaned dairy calves. Prof. Prof. Anim. Sci 29:116–123.
[14] Bampidis, V. A., V. Christodoulou, P. Florou-Paneri, E. Christaki, A. B. Spais, and P. S. Chatzopoulou. 2005. Effect of dietary dried oregano leaves supplementation on performance and carcass characteristics of growing lambs. Animal Feed Science and Technology 121:285–295.
[15] Bañón, S., L. Méndez, and E. Almela. 2011. Effects of dietary rosemary extract on lamb spoilage under retail display conditions. Meat Science.
[16] Banziger, M., G. O. Edmeades, and H. R. Lafitte. 2002. Physiological mechanisms contributing to the increased N stress tolerance of tropical maize selected for drought tolerance. Field crops res. 75:223-233.
[17] Bartlett, K. S., F. K. McKeith, and M. J. VandeHaar. 2006. Growth and body composition of dairy calves fed milk replacers containing different amounts of protein at two feeding rates. J. Anim. Sci 84: 1454–1467.
[18] Beharka, A. A., T.G.Nagaraja, and J.L.Morrill. 1991. Performanceand ruminal functiondevelopmentofyoungcalvesfeddietswithAspergillus oryzae fermentationextract. J.DairySci 74:4326– 4336.
[19] Beharka, A. A., T.G.Nagaraja, J.L.Morrill, G.A.Kennedy, and R.D.Klemm. 1998. Effects off or mofthedieton anatomical,microbial,and fermentative development of therumen of neonatal calves. J.Dairy Sci 81:1946– 1955.
[20] Besser, T. E., C.C.Gay, and L.Pritchett. 1991. Comparisonofthree methods offeeding colostrum to dairy calves. J.Am.Vet.Med.Assoc 198:419– 422.
[21] Blaxter, K. L. and W. A. Wood. 1951. The nutrition of yaoung Ayrish calf. 1. The endogenouse nitrogen and energy metabolism of calf. Br. j. Nutr 5(1):1-12.
[22] Blome, R. M., J. K. Drackley, McKeith, and F. K. 2003. Growth, nutrient utilization, and body composition of dairy calves fed milk replacers containing different amounts of protein. J. Anim. Sci 81:1641-1655.
[23] Blum, J. W. 2006. Nutritional physiology of neonatal calves. J. Anim.Physiol. Anim. Nutr: (Berl.) 90:91–11.
[24] Blum, J. W. and C. R. Baumrucker. 2002. Colostral and milk insulinlike growth factors and related substances: Mammary gland and neonatal (intestinal and systemic) targets. Domest. Anim. Endocrinol 23:101–110.
[25] BOMBIK, T., E. BOMBIK, A. FRANKOWSKA, B. TRAWIŃSKA, and L. SABA. 2012. EFFECT OF HERBAL EXTRACTS ON SOME HAEMATOLOGICAL
PARAMETERS OF CALVES DURING REARING. Bull Vet Inst Pulawy 56:655-658.
[26] Booth, A. J. and J.M.Naylor. 1987. Correction ofmetabolic acidosisin diarrheal calves byoral administration of electrolytesolution swithor without bicarbonate. J.Am.Vet.Med.Assoc 191:62– 68.
[27] Brown, E. G., M. J. Vandehaar, K. M. Daniels, J. S. Liesman, L. T. Chapin, J. W. Forrest, R. M. Akers, R. E. Pearson, and M. S. W. Nielsen. 2005. Effect of increasing energy and protein intake on mammary development in heifer calves. J. Dairy Sci 88:595–603.
[28] Brown, E. G., M. J. Vandehaar, K. M. Daniels, J. S. Liesman, L. T. Chapin, J. W. Forrest, R. M. Akers, R. E. Pearson, and M. S. W. Nielsen. 2005. Effect of increasing energy and protein intake on mammary development in heifer calves. J. Dairy Sci. 88:595–603.
[29] Brownlee, A. 1956. Thedevelopmentofrumenpapillaeincattlefedon different diets. Br.Vet.J 112:369– 375.
[30] C.L, D. and J.H.Clark. 1981. Ruminant digestion and metabolism. Dev. Ind.Microbiol 22:247– 259.
[31] Calsamigilia, S., M. Busquet, P. W. Cardozo, L. Castillejos, and A. Ferret. 2007. Invited review: Essential oil as modifiers of rumen microbial fermentation. J. Dairy Sci. 90: 2580-2595.
[32] Chao, S. C., D. G. Young, and C. J. Oberg. 2000. Screening for inhibitory
activity of essential oils on selected bacteria, fungi and viruses. Journal of
Essential Oil Research 12: 639–649.
[33] Chaves, A. V., K. Sanford, L. L. Gibson, T. A. McAllister, and C. Benchaar. 2008. Effect of carvacrol and cinnamaldehyde on intake, rumen fermentation, growth performance and carcass characteristics of growing lambs. Anim. Feed. Sci.Tech 145:396-408.
[34] Council, N. R. 2001. Nutrient requirements of dairy cattle. 7th edition. Washington. DC: National Academy Press.
[35] Curnick, K. E., L.D.Muller, J.A.Rogers, T.J.Snyder, and T.F.Sweeney. 1983. Addition of sodium bicarbonate tocalf starter rations varying inprotein percent. J.DairySci 66:2149– 2160
[36] Davis, C. L. and J.K.Drackley. 1998. The Development,Nutrition,and Management of theYoung Calf. Iowa State University Press,Ames,Iowa.
[37] Davis Rincker, L. E., M. J. VandeHaar, C. A. Wolf, J. S. Liesman, L. T. Chapin, and M. S. W. Nielsen. 2011. Effect of intensified feeding of heifer calves on growth, pubertal age, calving age, milk yield, and economics. J. Dairy Sci 94:3554–3567.
[38] de Passillé, A. M. B. 2001. Sucking motivation and related problems in calves. Appl. Appl. Anim. Behav. Sci 72:175–187
[39] de Passillé, A. M. B. and J. Rushen. 2006. Calves’ behaviour during nursing is affected by feeding motivation and milk availability. Appl. Anim. Behav. Sci. 101:264–275.
[40] De Paula Vieira, A., M. A. G. v. Keyserlingk, and D. M. Weary. 2010. Effects of pair versus single housing on performance and behavior of dairy calves before and after weaning from milk. J. Dairy Sci 93:3079–3085.
[41] Diaz, M. C., M. E. V. Amburgh, and J. M. Smith. 2001. Composition of growth of Holstein calves fed milk replacer from birth to 105-kilogram body weight. J. Dairy Sci 84: 830–842.
[42] Diaz, M. C., M. E. V. Amburgh, J. M. Smith, J. M. Kelsey, and E. L. Hutten. 2001. Composition of growth of Holstein calves fed milk replacer from birth to 105-kilogram body weight. J. Dairy Sci. 84:830–842.
[43] Donnelly, P. E. and J. B. Hutton. 1976a. Effect of dietarry protein and energy on growth of Friesian bull calves. I. food intake, growth, and protein requirements. N. Z. J. Agri. Res 19:289-297.
[44] Donnelly, P. E. and J. B. Hutton. 1976b. Effects of dietary protein and energy on growth of Friesian bull calves. II. Effects of level of feed intake and dietary protein content on body composition. N. Z. J. Agri. Res 19: 409–414.
[45] Donovan, D. C., S. T. Franklin, C. C. L. Chase, and A. R. Hippen. 2002. Growth and health of Holstein calves fed milk replacers supplemented with antibiotics or enteroguard. J. Dairy. Sci. 85:947-950.
[46] Drackley, J. K. 2008. Calf nutrition from birth to breeding. Vet. Clin. North Am. Food Anim. Pract. 24:55–86.
[47] Drackley, J. K. 2008. Calf nutrition from birth to breeding. Vet. Clin North Am. Food Anim . Pract 24:55–86.
[48] Eicher-Pruiett, S. D., J.L.Morrill, T.G.Nagaraja, J.J.Higgins, N.V.Anderson, and P.G.Reddy. 1992. Response of young dairy calves with lasalocid delivery varied in feed sources. J.DairySci 75:857– 862.
[49] Foley, J. A. and D.E.Otterby. 1978. Availability, storage, treatment,composition, and feeding value of surplus colostrum:areview. .J.Dairy Sci 61:1033– 1060.
[50] Forbes, J. M. 1971. Physiological changes affecting voluntary food intake
in ruminants. Proc. Nutr. Soc. 30:135–142.
[51] Galambosi, B. 1994. Herb production in Finland during 1981-1993. Proc. NJF Seminar No. 240. Scandinavian Assoc. of Agri. Sci. Helsinki, Finland,pp. 22-25.
[52] Galyean, M. L., L. J. Perino, and G. C. Duff. 1999. Interaction of cattle health/immunity and nutrition. J. Anim. Sci. 77:1120–1134.
[53] Garry, F. B., M. B. R.Adams, Cattell, and R.P.Dinsmore. 1996. Comparison of passive immunoglobulin transfer to dairy calves fed colostrum or commercially available colostral supplement products. J.Am.Vet.Med 1:107– 110.
[54] Gerrits, W. J. J., E. Decuypere, M. W. A. Verstegen, and V. Karabinas. 1998. Effect of protein-free energy intake on plasma concentrations of insulin-like growth factor I and thyroid hormones in preruminant veal calves. J. Anim. Sci 76:1356–1363.
[55] Ghalamkari, G., M. Toghyani, E. Tavalaeian, N. Landy, Zahra, Ghalamkari, and H. Radnezhad. 2011. Efficiency of different levels of Satureja hortensis L. (Savory) in comparison with an antibiotic growth promoter on performance, carcass traits, immune responses and serum biochemical parameters in broiler chickens. African Journal of Biotechnology 10:13318-13323.
[56] Giordani, R., P. Regli, J. Kaloustian, C. Mika¨ıl, L. Abou, and H. Portugal. 2004. Antifungal effect of variousessential oils against Candida albicans.Potentiation of antifungal action of Amphotericin B by essential oil from
Thymus vulgaris. Phytotherapy Research 18: 990–995.
[57] Godden, S. M., J. P. Fetrow, J. M. Feirtag, L. R. Green, and S. J. Wells. 2005. Economic analysis of feeding pasteurized nonsaleable milk versus conventional milk replacer to dairy calves. J. Am. Vet. Med. Assoc
226:1547–1554
[58] Greenwood, R. H., J.L.Morrill, E.C.Titgemeyer, and G.A.Kennedy. 1997. A new method of measuring dietabrasionandits effectonthe development of the for estomach. J.DairySci 80:2534– 2541.
[59] Griebel, P. J., M. Schoonderwoerd, and L. A. Babiuk. 1987. Ontogeny of the immune response: effect of protein energy mal nutrition in neonatal calves. Can. J. Vet. Res 51:428–435.
[60] Grzanna, R., L. Lindmark, and C. Frondoza. 2005. Ginger--an herbal medicinal product with broad anti-inflammatory actions. J Med Food 8:125-132.
[61] Guilloteau, P., I. L. Huërou-Luron, J. A. Chayvialle, R. Toullec, R. Zabielski, and J. W. Blum. 1997. Gut regulatory peptides in young cattle and sheep. Zentralbl. Veterinarmed 44:1-23.
[62] Hammon, H. M. and J.W.Blum. 1998. Metabolic ande ndocrine traits of neonatal calves arein fluenced by feeding colostrum for different durations or only milk replacer. J.Nutr 128:624– 632.
[63] Hammon, H. M., G. Schiessler, A. Nussbaum, and J. W. Blum. 2002. Feed intake patterns, growth performance, and metabolic and endocrine
traits in calves fed unlimited amounts of colostrum and milk by automate, starting in the neonatal period. J. Dairy Sci. 85:3352–3362.
[64] Hart, K. J., D. R. Ruzi, S. M. Duval, N. R. McEwan, and C. J. Newbold. 2007. Plant extract to manipulate rumen fermentation. Anim. Feed. Sci. Tech. 54:588-596.
[65] Heinrichs, A. J. 1993. Raising dairy replacement stomeetthe needs of the 21st century. J.DairySci 76:3179– 3187.
[66] Heinrichs, A. J. and G.J.Bush. 1991. Evaluation of decoquinateor lasalocid against coccidiosis from natural exposure in neonatal dairy calves. J.DairySci 74:3223– 3227.
[67] Heinrichs, A. J., S.J.Wells, and W.C.Losinger. 1995. Astudyofthe use of milk replacers for dairy calves in the United States. J.Dairy Sci 78:2831– 2837.
[68] Hill, S. R., K. F. Knowlton, K. M. Daniels, R. E. James, R. E. Pearson, and A. V. Capuco. 2008. Effects of milk replacer composition on growth, body composition, and nutrient excretion in preweaned Holstein heifers. J. Dairy Sci 91:3145–3155.
[69] Hill, T. M., J. M. Aldrich, R. L. Schlotterbeck, and H. G. Bateman. 2006. Effects of feeding calves different rates and protein concentrations of twenty percent fat milk replacers on growth during the neonatal period. Prof. Anim. Sci
22:252–260
[70] Hill, T. M., H. G. Bateman, J. M. Aldrich, and R. L. Schlotterbeck. 2009. Effects of fat concentration of a high-protein milk replacer on calf performance. J. Dairy Sci 92:5147–5153.
[71] Hodgson, J. 1971. The development of solid food intake in calves.5.The relationship between liquid and solid food intake. Anim.Prod 13:593– 597.
[72] Hopkins, B. A. and I. J.D.Quigley. 1997. Effects of method of colostrum feeding and colostrum supplementation onc oncentrations of immunoglobulin Ginthe serum of neonatal calves. J.DairySci 80:979– 983.
[73] Horosova, K., D. Bujnakova, V. Kme, and 2006. Effect of oregano essential oil on chicken Lactobacilli and E.coli. Folla Microbiol 51:278-280.
[74] http://animalherb.blogfa.com/page/1.aspx.
[75] Huber, J. T., A. G. Silva, and O. F. Campos. 1984. Influence of feeding different amounts of milk on performance, health, and absorption capability of baby calves. J. Dairy Sci 67: 2957–2963.
[76] Jasper, J. and D. M. Weary. 2002. Effects of ad libitum milk intake on dairy calves. J. Dairy Sci. 85:3054–3058.
[77] Jasper, J. and D. M. Weary. 2002. Effects of ad libitum milk intake on dairy calves. J. Dairy Sci 85:3054–3058.
[78] Jaster, E. H., G. C. McCoy, N. Spanski, and T. Tomkin. 1992. Effect of extra energy as fat or milk replacer solids in diets of young dairy calves on growth during cold weather. J. Dairy Sci. 75:2524-2531.
[79] Jenkins, K. J., J.K.G.Kramer, F.D.Sauer, and D.B.Emmons. 1985. Influence oftriglyceridesandfreefattyacidsinmilkreplacersoncalf performance, bloodplasma,andadiposelipids. J.DairySci 68:669– 680.
[80] Jenny, B. F., S. E. Mills, W. E. Johnston, and G. D. Dell. 1978. Effect of fluid intake and dry matter concentration on scours and water intake in calves fed once dialy. J. Dairy Sci. 61:765-770.
[81] K, P. A. 2011. Effects of essential oils on rumen fermentation, microbial
ecology and ruminant production. Asian Journal of Animal and Veterinary
Advances 6:416-428.
[82] Kaneko, J. J., J. W. Harvey, and M. L. Bruss. 2008. Clinical Biochemistry of Domestic Animals. 6th Edition, Academic Press, London: 117–138.
[83] Kertz, A. F., L.F.Reutzel, and J.H.Mahoney. 1984. Adlibitum water intake by neonatal calves and itsrelation ship to calf starter intake, weight gain,fecal score,and season. J.DairySci 76:2964– 2969.
[84] Kertz, A. F., L.R.Prewitt, and J. J.P.Everett. 1979. An early weaning calf program:summarization and review. J.DairySci 62:1835– 1843.
[85] Kertz, A. F., L. R. Prewitt, and J. P. E. Jr. 1979. An early weaning calf program: Summarization and review. J. Dairy Sci 62:1835–1843.
[86] Khaki, A. 2010. Antioxidant effect of ginger to prevents lead-induced liver tissue apoptosis in rat. Journal of Medicinal Plants Research 4(14):1492-1495.
[87] Khan, M. A., H. J. Lee, W. S. Lee, H. S. Kim, K. S. Ki, T. Y. Hur, G. H. Suh, S. J. Kang, and Y. J. Choi. 2007. Structural growth, rumen development, and metabolic and immune responses of Holstein male calves fed milk through step-down and conventional methods. J. Dairy Sci 90:3376–3387.
[88] Khan, M. A., H. J. Lee, W. S. Lee, H. S. Kim, S. B. Kim, K. S. Ki, J. K. Ha, H. G. Lee, and Y. J. Choi. 2007. Pre- and postweaning performance of Holstein female calves fed milk through step-down and conventional methods. J. Dairy Sci. 90:876–885.
[89] Khan, M. A., D. M. Weary, and M. A. G. v. Keyserlingk. 2011. Effects of milk ration on solid feed intake, weaning, and performance in dairy heifers. J. Dairy Sci. 94:1071–1081.
[90] Kholif, S., T. Morsy, M. Abdo, O. Matloup, and A. A. A. El-Ella. 2012. Effect of Supplementing Lactating Goats Rations with Garlic, Cinnamon or Ginger Oils on Milk Yield, Milk Composition and Milk Fatty Acids Profile. J Life Sci 4(1):27-34.
[91] Kristensen, J. S. N. B., S. K. Jensen, and M. Vestergaard. 2007. Effect of milk allowance on concentrate intake, ruminal environment, and ruminal development in milk-fed Holstein calves. J.Dairy Sci 90:4346–4355.
[92] Lammers, B. P., A.J.Heinrichs, and A.Aydin. 1998. The effect of whey protein concentrate or dried skim milk in milk replacer on calf performance and blood metabolites. J.DairySci 81:1940– 1945.
[93] Lesmeister, K. E. and A. J. Heinrichs. 2004. Effects of corn processing on growth characteristics, rumen development, and rumen parameters in neonatal dairy calves. J. Dairy Sci. 87:3439–3450.
[94] Lofgreen, C. P. and M. Kleiber. 1953. The method fecal nitrogen excretion of the yaoung calf and true digesibility of casein. j. Nutr 49:183-190.
[95] McCoy, G. C., J.K.Reneau, A.G.Hunter, and J.B.Williams. 1970. Effects of dietandtimeon blood serum proteins in the new borncalf. J. DairySci 53:358– 362.
[96] McGavin, M. D. and J.L.Morrill. 1976. Scanning electron microscopy of ruminal papillae in calves fed various amounts and forms of roughage. J.VetRes 37:497– 508.
[97] Miller-Cushon, E. K., R. Bergeron, K. E. Leslie, and T. J. DeVries. 2013. Effect of milk feeding level on development of feeding behavior in dairy calves. J. Dairy Sci 96:551–564.
[98] Moallem, U., D. Werner, H. Lehrer, M. Zachut, L. Livshitz, S. Yakoby, and A. Shamay. 2010. Long-term effects of ad libitum whole milk prior to weaning and prepubertal protein supplementation on skeletal
growth rate and first-lactation milk production. J. Dairy Sci. 93:2639–2650.
[99] Morin, D. E., G.C.McCoy, and W.L.Hurley. 1997. Effects of quality, quantity, and timing of colostrum feeding and addition of a colostrum supplement on immunoglobulinG1 absorptionin Holstein bull calves. J. DairySci 80:747– 753.
[100] Morrill, J. L., A.D.Dayton, and R.Mickelsen. 1977. Cultured milk and antibiotics for young calves. J.DairySci 60:1105– 1109.
[101] Morrill, J. L., J.M.Morrill, A.M.Feyerherm, and J.F.Laster. 1995. Plasma proteins and aprobiotic a singredients in milkreplacer. J.Dairy Sci 78:902– 907.
[102] Mylrea, P. J. 1966. Digestion in young calves fed whole milk ad lib. and its relation ship to calf scours. Res. Vet. Sci. 7:407–416.
[103] NAHMS. 2007. Dairy 2007, part I: Reference of Dairy Cattle Health and Management Practices in the United States. Accessed July 8, 2009. http://nahms.aphis.usda.gov/dairy/dairy07/dairy2007_ highlightsPt1.pdf
[104] Nonnecke, B. J., M. R. Foote, J. M. Smith, B. A. Pesch, and M. E. V. Amburgh. 2003. Composition and functional capacity of blood mononuclear leukocyte populations from neonatal calves on standard and intensified milk replacer diets. J. Dairy Sci 86:3592–3604.
[105] Obeidat, B. S., C. J. Cobb, M. D. Sellers, A. R. Pepper-Yowell, T. J. Earleywine, and M. A. Ballou. 2013. Plane of nutrition during the preweaning period but not the grower phase influences the neutrophil activity of Holstein calves. J. Dairy Sci 96:1–12.
[106] Orskov, E. R. 1972. Reflex closure of the oesophagealgrooveandits potential application in ruminant nutrition.S.Af. J.Anim.Sci 2:169– 176.
[107] Ozkan, G., B. Simsek, and H. Kuleasan. 2007. Antioxidant activities of Satureja cilicica essential oil in butter and in vitro. Journal of Food Engineering 79:1391-1396.
[108] PettyJohn, D., J. P. Everett, and R. D. Mochrie. 1963. Responses of Dairy Calves to Milk Replacer Fed at Various Concentrations. J. Dairy Sci. 46:710-714.
[109] Phillips, R. W. 1985. Fluid ther apy for diarrheic calves.What,how and how much?Vet.Clin.North Am. Food Anim.Pract 1:541-562.
[110] Pollock, J. M., T.G.Rowan, J.B.Dixon, S.D.Carter, D.Spiller, and H. Warenius. 1993. Alteration of cellular immune responses by nutrition and weaning in calves. Res.Vet.Sci 55:298– 306.
[111] Preston, T. R. 1963. The nutrition of early weaned calf. World Rev. Nutr. Diet 4:117-139.
[112] Pritchett, L. C., C.C.Gay, T.E.Besser, and D.D.Hancock. 1991. Management and production factors in fluenc ing immunoglobulinG1 concentration in colostrum from Holstein cows. J.DairySci 74:2336– 2341.
[113] Qiao, G., C. Shao, T. Shao, X. Yang, X. Zhu, J. Li, and Y. Lu. 2013. Effects of supplemental Chinese herbs on growth performance, blood antioxidant function and
immunity status in Holstein dairy heifers fed high fibre diet. Italian Journal of Animal Science 12:e20.
[114] Quigley, I., J.D. 1996. Feeding prior to weaning.In Calves, Heifers and Dairy Profit ability.Facilties, Nutrition,and Health. Northeast Regional Agricultural Engineering Service, Ithaca,NY:245– 255.
[115] Quigley, I., J.D and J.J.Drewry. 1998. Nutrient and immunity transfer from cow to calf pre-and post calving. J.DairySci 81:2779– 2790.
[116] Quigley, I., J.D, J.J.Drewry, L.M.Murray, and S.J.Ivey. 1997a. Body weight gain,feed efficiency and fecal scores of dairy calvesin response togalactosyl-lactoseor antibiotics in milk replacers. J.Dairy Sci 80:1751– 1754.
[117] Quigley, I., J.D, J.J.Drewry, L.M.Murray, and S.J.Ivey. 1997b. Effects of lasalocid in milk replacer or calf starter on health and performance of calves challenged with Eimeriaspecies. J.DairySci 80:2972– 2976.
[118] Quigley, I., J.D, L.B.Wallis, H.H.Dowlen, and R.N.Heitmann. 1992. Sodium bicarbonate and yeas tculture effects on ruminal fermentation,growth, and in takein dairy calves. J.DairySci 75:3531– 3538.
[119] Radostits, O. M., C. C. Gay, D. C. Blood, and K. W. Hinchcliff. 2007. Veterinary Medicine. 10th Edition, Baillier Tindall, London, Philadelphia, New York:303–311.
[120] Raeth-Knight, H. C.-J. M., S. Hayes, J. Linn, R. Larson, D. Ziegler, B. Ziegler, and N. Broadwater. 2009. Impact of conventional or intensive milk replacer programs on Holstein heifer
performance through six months of age and during first lactation. J. Dairy Sci. 92:799–809.
[121] Raven, A. M. 1970. Fatin milk replacers for calves. J.Sci.Food Agric 21:352– 359.
[122] Reddy, P. G., J.L.Morrill, H.C.Minocha, M.B.Morrill, A.D.Dayton, and R.A.Frey. 1986. Effect of supplemental vitamin E on theimmune system of calves. J.DairySci 69:164– 171.
[123] Research Council, N. 1968. Prenatal and Post natal Mortalityin Cattle, Publication1685. Washington,DC:Natl.Acad.Sci.
[124] Research Council, N. 1989. Nutrient Requirements of DairyCattle, 6th rev.ed.Washington,DC. National Academy Press.
[125] Richard, A. L., L. D. Muller, and A. J. Heinrichs. 1988. Ad libitum or twice daily feeding of acidified milk replacer to calves housed individually in warmand cold environments. J. Dairy Sci 71: 2193–2202.
[126] Ridder, T. A., J.W.Young, K.A.Anderson, D.W.Lodman, K.G.Odde, and D.E.Johnson. 1991. Effects of prepartum energy nutrition and body condition on birth weight and basal metabolism in bovineneonates. J.Anim.Sci 69(Suppl.1):450.
[127] Roth, B. A., N. M. Keil, L. Gygax, and E. Hillmann. 2009. Influence of weaning method on health status and rumen development in dairy calves. J. Dairy Sci 92:645-656.
[128] Rowan, T. G. 1992. Thermo regulation in neonatal ruminants. Anim.Prod 15:13– 24.
[129] Roy, J. H. 1970. Protein in milk replacers for calves. J. Sci. Food Agric 21(7):364-351.
[130] Rushen, J. and A. M. d. Passillé. 1995. The motivation of non-nutritive sucking in calves, Bos taurus. Anim. Behav 49:1503–1510.
[131] Sander, E. G., R.G.Warner, H.N.Harrison, and J.K.Loosli. 1959. The stimulatory effect of sodium butyrate and sodium propionateon the development of rumen mucosa in the young calf. J.DairySci 42:1600– 1605.
[132] Sander, E. G., H. N. Warner, H. N. Harrison, and J. K. Loosli. 1959. The stimulatory effect of sodium butyrate and sodium propionate.
[133] Savage, E. S. and C. M. McCay. 1942. The nutrition of calves. J. Dairy Sci. 25:595–650.
[134] SchiDgoetbe, D. J., D. P. Casper, J. K. Drackley, and F. C. Ludens. 1986. Increased solids intake and feediDg fnlqumcy for calves in hutches duriDg cold weather. J.Dairy Sci 69:1063.
[135] Schrama, J. W., A. Arieli, and W. V. D. Hel. 1993. Evidence of increasing thermal requirement in young, unadapted calves during 6 to 11 days of age. J. Anim Sci 71:1761–1766.
[136] Senn, M., S. Gross-Luem, H. Leuenberger, and W. Langhans. 2000. Meal patterns and meal-induced metabolic changes in calves fed milk ad lib. . Physiol. Behav. 70:189–195.
[137] Shasany, A. K., D. saikia, and s. p. s. khanuja. Medicinal plant trade, value addition and biotechnology. Proceeding of First National Interactive Meet on Meet on Medicinal and Aromatic plants (eds. A. K. mathar et al.) Cimap, Lucknow, UP, Indian, pp. 68-70.
[138] Shen, Z., H. M. Seyfert, B. Lohrke, F. Schneider, R. Zitnan, A. Chudy, S. Kuhla, H. M. Hammon, J. W. Blum, H. Martens, H. Hagemeister, and J. Viogt. 2004. An energy rich diet causes rumen papillae proliferation associated with more IGF type 1 receptors and increased plasma IGF-1 concentrations in young goats. J. Nutr 134:11-17.
[139] Smith, B. P. 2009. Large Animal Internal Medicine. 4th Edition, Mosby Pub, USA.
[140] Smith, J. M., M. E. V. Amburgh, M. C. Diaz, M. C. Lucy, and D. E. Bauman. 2002. Effect of nutrient intake on the development of the somatotropic axis and its responsiveness to GH in Holstein bull calves. J. Anim. Sci. 80:1528–1537.
[141] Soberon, F., E. Raffrenato, R. W. Everett, and M. E. V. Amburgh. 2009. Early life management and long term productivity of dairy calves. J. Dairy Sci. 92:238.
[142] Soberon, F., E. Raffrenato, R. W. Everett, and M. E. V. Amburgh. 2012. Preweaning milk replacer intake and effects on long-term productivity of dairy calves. J. Dairy Sci 95:783–793.
[143] Soberon, F., R. W. Raffrenato, Everett, and M. E. V. Amburgh. 2009. Early life management and long term productivity of dairy calves. J. Dairy Sci 92:238
[144] Soltan, M. A. 2009. Effect of Essential Oils Supplementation on Growth Performance, Nutrient Digestibility, Health Condition of Holstein Male Calves During Pre- and Post-Weaning Periods. Pakistan Journal of Nutrition 8 (5):642-652.
[145] Stamey, J. A., N. A. Janovick, A. F. Kertz, and J. K. Drackley. 2012. Influence of starter protein content on growth of dairy calves in an enhanced early nutrition program. J. Dairy Sci 95:3327–3336.
[146] Stobo, I. J. and J. H. Roy. 1973. The protein requirement of rumininant calf. 4. Nitrogen balance studies on repidly geowing given diets of diffrent protein content. Br. J. Nutr:113-125.
[147] Stobo, I. J. F., J. H. B. Roy, and H. J. Gaston. 1966. Rumen development in the calf. 1. The effect of diets containing different proportions of concentrates to hay on rumen development. Br. J. Nutr 20:171–188.
[148] suarez cretton, b. j. 2006. Rumen development in veal (preruminant) calves. Wageningen university dissertation no.4071, Wageningen, The netherlands:19-46.
[149] Sudipta, G., R. K. Mehla, S. K. Sirohi, and B. Roy. 2010. The effect of dietary garlic supplementation on body weight gain, feed intake, feed conversion efficiency, faecal score, faecal coliform count and feeding cost in crossbred dairy calves. Trop. Anim. Health Prod. 42:961–968.
[150] Svensson, C., K. Lundborg, U. Emanuelson, and S. Olsson. 2003. Morbidity in Swedish dairy calves from birth to 90 days of age and individual calf-level risk factors for infectious diseases. Prev. Vet. Med. 58:179–197.
[151] Sweeney, B. C., J. P. Rushen, D. M. Weary, and A. M. B. d. Passillé. 2010. Duration of weaning, starter intake, and weight gain of dairy calves fed large amounts of milk. J. Dairy Sci. 93:148–152.
[152] Tamate, H., A. D. McGilliard, N. L. Jacobson, and R. Getty. 1962. Effect of various dietaries on the anatomical development of the stomach in the calf. J. Dairy Sci 45:408–420.
[153] Terosky, T. L., A.J.Heinrichs, and L.L.Wilson. 1997. Acomparison of milkproteinsourcesindietsofcalvesuptoeightweeksofage. J. DairySci 2977– 2983:80.
[154] Terré, M., M. Devant, and A. Bach. 2007. Effect of level of milk replacer fed to Holstein calves on performance during the preweaning period and starter digestibility at weaning. Livest. Sci. 110:82–88.
[155] Thomas, T. J., D. M. Weary, and M. C. Appleby. 2001. Newborn and 5-week-old calves vocalise in response to milk deprivation. Appl. Anim. Behav. Sci. 74:165–173.
[156] Tikofsky, J. N., M. E. V. Amburgh, and D. A. Ross. 2001. Effect of varying carbohydrate and fat content of milk replacer on body composition of Holstein bull calves. J. Anim Sci 79:2260–2267.
[157] Toullec, R. and P.Guilloteau. 1989. Researchin to the digestive physiology of the milk-fed calf. In:Nutrition and Digestive Physiologyin Monogastric Farm Animals,edited by E.J.Van WeerdonandJ.Huisman:37– 55.
[158] V, C. A., K. Stanford, L. L. Gibson, T. A. McAllister, and C. Benchaar. 2008. Effects of carvacrol and cinnamaldehyde on intake, rumen fermentation, growth performance, and carcass characteristics of growing lambs. Animal Feed Science and Technology 145:396–408.
[159] Van Amburgh, M. and J. Drackley. 2005. Current perspectives on the energy and protein requirements of the pre-weaned calf. In: Garnsworthy PC, editor. Calf and heifer rearing. Nottingham (UK): Nottingham University Press.
[160] Van Saun, R. J., T.H.Herdt, and H.D.Stowe. 1989a. Maternaland fetal seleniumconcentrationsandtheirinterrelationshipsindairycattle. j. Nutr 119:1128– 1113.
[161] von Keyserlingk, M. A. G., J. Rushen, A. M. B. d. Passillé, and D. M. Weary. 2009. Invited review: The welfare of dairy cattle-Key concepts and the role of science. J. Dairy Sci. 92:4101-4111.
[162] Walker, P. G., P.D.Constable, D.E.Morin, J.K.Drackley, J.H.Foreman, and J.C.Thurmon. 1998. Areliable,practical,andeconomical protocolforinducing diarrhea and severe dehydration in the neonatal calf. Can.J.Vet.Res 62:205– 213.
[163] Warner, R. G. 1991. Nutritional factors affecting the development of afunctional ruminant—A historical perspective. Proc.CornellNutr. Conf: 1– 12.
[164] Warner, R. G., W. P. Flatt, and J. K. Loosli. 1956. Dietary factors influencing the development of the animal’s stomach. Journal of Agricultural and Food Chemistry 4:788–792.
[165] Webster, A. J. F., H.Donnelly, J.M.Brockway, and J.S.Smith. 1975. Energy exchanges of veal calves fed high-fat milk replacer diet containing different amountsofiron. Anim.Prod 20:69– 75.
[166] Williams, A. P. 1994. Amino acid requirements of the veal calf and beef steer. In: D’Mello JPF, editor. Amino acids in farm animal nutrition. CAB International.
[167] Williams, P. E. V. and A.J.Frost. 1992. Feeding the young ruminant.In Neonatal Survivaland Growth, edited by M.Varley,P.E.V.Williams, and T.L.J.Lawrence, Occasional Publ. Anim.Prod 15:109– 118.
[168] Williams, P. E. V. and A. J. Frost. 1992. Feeding the young ruminant. Pages 109–118 in Neonatal Survival and Growth. Occasional Publ. No. 15. M. Varley, P. E. V. Williams, and T. L. J. Lawrence, ed. Br. Soc. Anim. Prod., Edinburgh, UK.
[169] Williams, P. E. V. and A. J. Frost. 1992. Feeding the young ruminant. Br. Soc. Anim. Prod., Edinburgh, UK 109-118.
[170] Wilson, G. A. and J.V.Wheelock. 1972. .Factors affectingtheaction of rennin in heated milk. J.DairyRes 39:413– 419.
[171] Yesilbag, D., M. Eren, H. Agel, A. Kovanlikaya, and F. Balci. 2011. Effects of dietary rosemary, rosemary volatile oil and vitamin E on broiler performance, meat quality and serum SOD activity. British Poultry Science 52(4):472-482.
[172] Zhang, G. F., Z. B. Yang, Y. Wang, W. R. Yang, S. Z. Jiang, and G. S. Gai. 2009. Effects of ginger root (Zingiber officinale) processed to different particle sizes on growth performance, antioxidant status, and serum metabolites of broiler chickens. Poultry Science 88 2159-2166.